SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for BDET_06709 from Batrachochytrium dendrobatidis JEL423

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BDET_06709
Domain Number 1 Region: 353-449
Classification Level Classification E-value
Superfamily HMG-box 1.09e-18
Family HMG-box 0.001
Further Details:      
 
Domain Number 2 Region: 480-562
Classification Level Classification E-value
Superfamily HMG-box 0.000000000000183
Family HMG-box 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) BDET_06709
Sequence length 739
Comment | BDEG_06691 | Batrachochytrium dendrobatidis predicted protein (740 aa)
Sequence
MPAFQGQWFCDDANGGSASTGVRSNILTSASTFLTQANPLQISQPAHLQYQLNQAKQIQR
QLSNSTSTFPSTPNTVQTSSTHILQPSLLGGMSHTPHSTSTPVHGGSSLMNAMTTGFSTP
MAALTPIQGVSTASPAMIQMNHYNSMPISAGISSRPDLTQKQWMQSPLSPTASQPHTNGS
IVNSVHEEEAHSDSNQDKKENEPMQSRSLGQHVSTCHASTTASRSPVLNSMNTIDEKQVK
YKRKYVALKALVQISDHKIKRYTNSLAKARQKIAKLKLERRYNGDLTPTDEEDDGESSHS
EESFEDVEIEADERQTRHAKSDSDEDESEHDEEDGGEEDDIALDEITKVLIKPKTPRRKR
PKLLDPNAPKRPANAFMLFCDLQRENLKEERKELQKNMPGSEQEIALSNLTKALGHRWRG
LTESERKYYQNLFKEQVKQYDLELSNYFREHPDAAEAITNGTHISQALHNGGTEGGDESV
IDANAPKKPVNSFHVFCETERDLIKQERKRLKATHGGTEEDAGHVHINKELGLKWRALSD
ADRKVYTDKFKELLAVHNEYMEHRYNGDGKKEGGNMSTEALQSNTASSVISKTNTIQASS
PKNKTIAVAINNAEANTDTQSSDILDSFTIDSNKAGTVSEAQSDAGMISLEEFELDTAKI
ENRRHSSTETLESWDRNDCGNTDEESSQQEAQNADEDKHEKDDLEDGIQEENIGFVDLSE
MDLDSEMVDDATDELEAME
Download sequence
Identical sequences A0A177WV23
BDET_06709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]