SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for BDET_07150 from Batrachochytrium dendrobatidis JEL423

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BDET_07150
Domain Number 1 Region: 747-940
Classification Level Classification E-value
Superfamily Sec7 domain 1.16e-72
Family Sec7 domain 0.00000297
Further Details:      
 
Domain Number 2 Region: 1203-1633
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000000245
Family Armadillo repeat 0.079
Further Details:      
 
Weak hits

Sequence:  BDET_07150
Domain Number - Region: 1558-1638,1701-1754,1784-1908
Classification Level Classification E-value
Superfamily ARM repeat 0.00219
Family PBS lyase HEAT-like repeat 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) BDET_07150
Sequence length 1989
Comment | BDEG_07131 | Batrachochytrium dendrobatidis conserved hypothetical protein (1990 aa)
Sequence
MSSSPNGQHETSESASSVMTTETITADTPLTTQQSTHSAAASNTEISTMLYAVIIRASLL
ELQISSAKGNNSNSAKRVELKDACTKALILVNAGETDLKQVRDAVFLPLRLACELRTHPA
VPIAIDCIGKLFSYDFWGDSIPASELDSKPTLEPQAHLQSTNPSQDRINLHDDDDDDDGE
GHFASESPDLFNQALYRHLFVNTVVDVICASFNHTGQTDESTQLQIVKAITSAITTSNPR
SAIHGKLLLKAMRAVYNIFLHSKTTNVQTIAQASLTQIVQTVYSHIPESLGSSRFLVRHL
QRLGFDCGDVELTEDGSKLRDGDTGNEMKAVDYLTVESQPNNSMETDEDQSNNSIRHSKT
ASLDSLSQLSDRSASGSMPRKQSKRKTLVRTSQEIISAQSEARRLGLETVYDQHVKDAFL
VFRAICKLSMKPFGTADQPTDIKSIAMRSKLLSLHLVYQVLTLHKHVFFAPAPILFSWKN
HQATPTLPSVAFILAVKQYLCLVFTRNIVNVLPHVSEITMAIFGCILQDLRSILKKEILV
MMTEVILPFIEIKSGIPSSTYRQRVILCNSLHRSLSTHSQSGRMLVELYLNYDCDAHSGP
SENILERLVSAVAKLITSTADVIISEKSPQNIVVKSSGIWSGGSMPSFAIANLPHLTRDE
IREFYLASGDPNELKLCALQLLVSGVLKPLIGWCHERMSSVAAEEASLTKLASGTPDEFS
DKPKTVVPVWGGLDPTTGYYHGIDDPTAFETLKNKKRALIEGIKLFNYKPKKGMQFLLDS
NCISTRTPRDIARFLLTAEGLSKGMIGEFLGEGDDENIAIMHAFVDEMEFTNLGFVEALR
TFLQSFRLPGESQKIDRFMLKFAERYLKGNPKAFSSADTAYVLAYSVIMLNTDQHNAQVK
RKMTKADFLKNNRGIDEGKDLSINVLEQIFDEINANEIVMKDEVEKVAGSGGGDDNQDTL
NQPMRKLKIDQAGINLSLKTEAMFGIITRGSDKLDGSPVSPAHTNLSITNDSSSPTDSIF
ISATQFENVKPMFQLLWMSILMAISTPLQQSDNIDIIEVSLEGFKSATHLSCLFDLEFEK
RAFLSSLTKFTVLGNISEIKSKHLEAAKLLFRIALADGNSMGEYWGNIVRCVSQLENLQL
LGTQDSDDMTFRTPYDVRKDTSKPTAMQRIGDAITAAEIASQTMALSVDRIFTASAKLSG
SAILDFVRALCESSWDEIKSSSDREHPRMYCLQRLVEISYYNMRRIRVEWSNIWAILGKH
INQVGCHSNATVAYFALDKFRQLAMKFLELEELPNFKFQKDFLRPFEEIFRNNPDVKIKD
MCLVCLQQMVNAKSKNLMSGWKAMFSTFCRAAQEKHESIVMLAFEVVKSISINHLDLVIR
NYTFGDYVNCLVEFCKNQDFPKICLQSVELLHQAIVHVEKRLEAMSPNQLAFSTGENLSD
VVEHAMQLLSTPILPKPEMQVHIEQTTLADNPSIRFWFPVLFGLYEVVMTCDLEVRTRAL
NFLFDALDEHGNSFSQDFWSLIYKGVLLPIFDDLRITRSDQSKFSNREDMSVWLSTTLIL
ALRKFVKLFSNHYLALFFMFNEIVDLLLICMTQESETLSKIGSTCLQEFIEENATKFDAD
SWDKICDRLVYLCEFTMPDELFFDINEVVKQPLSVTTDKAPHSDSDTIPIHPPQLLQQSP
LPIEKEPQRPLCATGRPYSHKPVKSEFQRIIFKCVLHLQVIQTLQELLSTDHNPTVYNSL
QSYQVLKLVDCLFQSYKFAKLFNADGELRTMLFRMGFMKQPPNLLKQETLSISGYFMALF
CMFGDMSKERISSHDQIKQRLIPLAYDVLCYYNTLDPESRKRNISAWRPVVQIILNGLSR
FTDSQFSEHIWQFYHPVVGLIQFDMPFEARQTIRTILVRGGIVFGANATSAASSTYTDIP
HLMTIKKTDSVIESATMTTTPTHDKPFQASSSMQSSSADMQTSCDDACVLVTDPANISSN
LLAEQTIHE
Download sequence
Identical sequences A0A177WWL1
BDET_07150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]