SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for BDET_07189 from Batrachochytrium dendrobatidis JEL423

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BDET_07189
Domain Number 1 Region: 761-953
Classification Level Classification E-value
Superfamily Sec7 domain 4.58e-70
Family Sec7 domain 0.00000483
Further Details:      
 
Domain Number 2 Region: 424-630,664-683,1077-1132,1282-1427,1499-1558,1606-1648
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000041
Family Plakophilin 1 helical region 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) BDET_07189
Sequence length 2017
Comment | BDEG_07170 | Batrachochytrium dendrobatidis conserved hypothetical protein (2018 aa)
Sequence
MLQHCLERLLAESVKFKDLRESVQEALETFAAQQKALQLAGDDPSKISLCVIQKPDDPPS
AAAPQLQKQPASLSSPTHPTDVSVAESENANSDTPALETGTQYIESASTSFNHPVNSPTK
SAAELASETSIGKQLLQSTFLMDEIISTVISSINNQQSNAAEEALQLQVLQVLLTAVTST
ECEVHERSLLRKNSVNEVTAKASLTQMVNLIFSRMERYADVLTKALESGAPLTKLPRTSS
VIDLEPYAVSKMDTTFEQPQGSSEGLAITTTLAVSDESLPVIQTIKDENEFKSVETRSLD
ADTELTLESEAVSGSQNTVPLETSLVENLSISSEFLTSNIEAPVQIPPTSPLEEKKLATV
LGAVGLDVTDSNPYNPSVSFYNQLLRKDVYLVLRFLCYMSMHSDDQNQATTFNPATLSVG
NASLHDELSAASIKSRILAMELILSVLNNIGPVLHTDGLYVKLVRENLCLSVSRNAVNTN
PALFELSLSIFLLVIRYYRDKLKVEVEVLLSTIYLQILEMGNSTYKQKSIVLQGLVKICE
TPQTLVDLYVNYDCDMATSSVFEKIINICAKITQGRADLSSKSASHSSFAIVGFAVGLDS
KAELIREQDQKLKIKGLCALVAAIQSLDTWCQEPLPQDMPIVQNHDISQLLPESTDQTGS
DSANPDQAGSLEPLTMVGLNDKSGPIYAGPSSATKSLDGFSDTATAFMDALAPTNHARTV
VVGNRNPLLSVTMDKTIRKEFVDGLISKPAETNQQDMEQVVSRKQLLRRAVRIFNQSPKK
GIQALADIKFITLDPESISEFLLTTPELSKSAIGIYLGEGDPHNIKVMHAFVDALEFSGM
AFVAALRFFLQHFRLPGEAQKIDRMMEKFADRYCESNPGVFANADAAYTLAFSVMMLNTD
QHSSQIKNRMDKPAFIKNNKGINGDSDLPEEFLDAVFDEIAQNEIIMEEEHANGKLARIT
MGWGAGDLNDRQRMDMYRKEVNMIQKKSQMLMKAGSSNRGVTPFRSATGRELVRPMFAMA
AWALVATFSLLFESAVDEGLQNIDFASKLSNMAKPDLSTLCLRGFSGAIRIACTFKLETE
RDAFVSSLAKLTSLGNFYNIKPKNVMAIRTLIDLSQDLAESMESSWVQIIKTISQIERMQ
MAVLHSAQPNMEVNVGSSLRDNRSTDSHKSTSDRSFYSGETTDSGYRSSSFGDHLPKKIP
PALEHLVSDFQSQTSLIVIDRIFSKTINLSATAIIHFFRAVCQVSLEEVGIDAKGQPIMT
ATPGPPRMYLLQKIVEVAHYNVTRIRFEWTQIWRILQPHFSIVACHPNQHVATFAVDSLR
QLCMKFLEREELGHFSSQHEYLRSFEWIIRHTTSPAIRELVLQSITHMITAKATSIRSGW
KSIFVVLDKAEKGMNDCLRKGQGPAHDELVMGSIQLLRSCAKSLVERAKEEYELPNSKPR
TKRPSVYPISGAAPTLQSSSASTGVTAGTVSLSSPGAPRINNLPQQAYLMPNGCVSEGHF
YLSWFPILSAFSRVVIESEGVLVRTHTLETLFDMLRSASHLFDSKYWRTIHRNIISPIFE
DLSDPADEPAFGEANSAVLILGLRLLIEMISLHFDLLVRGSSDNTEHPDTGGQEFIQNSL
ERILFIMGKKDDKLAATGQICFQQFLLNNVHKLAKQGKWTWLVDSIEEAFKRTLPVELLN
CSGPFNPDLENSHGTTTLNNNVKDGYDPQGAAIASLSTLNRDLSQNYIIDMSEIMESAHA
VARETGVPLALDDLDFDHTIIKCVTHLELLQTVRDFCLTDISSSLDTVSCTDGVQRLGGK
TYAIGVMTAHDRDRILKCVYASYTLARSFNSLTDLRHAIWRRGWVSQLPNLVKQETVSFS
TLIVMLFGAYKTLGDSPTTLASTESQDSVGLKEHTKNPVMEALIKQSMDLLERYIVFLGD
AVKHSREIVLWSPIVVLFYRELLSTGDWWSQKGIAHSEPTETNDGKSKGVQLKALKKHLP
RYFRLAIRMMSVDRLEVRQVLQEFMERVGDEYICMNE
Download sequence
Identical sequences A0A177WUT0
BDET_07189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]