SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Batde5|29058|fgenesh1_pg.C_scaffold_213000001 from Batrachochytrium dendrobatidis JAM81

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Batde5|29058|fgenesh1_pg.C_scaffold_213000001
Domain Number 1 Region: 35-163
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 3.66e-24
Family GntR ligand-binding domain-like 0.019
Further Details:      
 
Domain Number 2 Region: 1-37
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000569
Family GntR-like transcriptional regulators 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Batde5|29058|fgenesh1_pg.C_scaffold_213000001
Sequence length 172
Sequence
VSRSTIKKALLKLQQEQLVEVQHNKGANVKSYTLEEVVNYLEIREVLEVLVAVNATSNIT
DMEITKLSETLNQMEEHLQNNRFGEYSKLNKVFHQIIYDTCSNKQAVEMINIIKTQLARF
QIRTLLVPGRNSNSYAEHSAILAGLKSRDEEAVSQAIQTHISNDEVSKGKGR
Download sequence
Identical sequences F4PG37
jgi|Batde5|29058|fgenesh1_pg.C_scaffold_213000001 XP_006683570.1.45406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]