SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Batde5|20656|estExt_Genewise1Plus.C_130138 from Batrachochytrium dendrobatidis JAM81

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Batde5|20656|estExt_Genewise1Plus.C_130138
Domain Number 1 Region: 30-141
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 2.01e-19
Family Rap30/74 interaction domains 0.0012
Further Details:      
 
Domain Number 2 Region: 212-275
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.37e-18
Family DNA-binding domain from rap30 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Batde5|20656|estExt_Genewise1Plus.C_130138
Sequence length 299
Sequence
MEDDVSDVSDDEVKPGLSESVDVKSLAGDSDDEFSLDHQDNAVWLVKVPNFLAEKWMQIG
FTHAGKDLGQVRIDKESTMQGNNPKVTLHIPDEPWSADLPKNYNLKFTNLAPKNEYVFTE
TSQGRAVGIAGIVQHEATVSPMVTDATHSAHYQRIMKKRTTTAATPSRVVKMIDENKTEH
RRLMGSASSDTWNAGLEHIKQKKSSKSLDKRERMTRSDLLNVLFPLFSGYPYWNFKGLVE
QTKQPHAWLKEILAEVCILNKRGPYTGMYQLKPEFVLGGQKPSNRPEKSTLGSFPSSTF
Download sequence
Identical sequences A0A177WSU0 F4PAV2
BDET_06606 XP_006681626.1.45406 jgi|Batde5|20656|estExt_Genewise1Plus.C_130138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]