SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Batde5|89091|GP3.046500 from Batrachochytrium dendrobatidis JAM81

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Batde5|89091|GP3.046500
Domain Number 1 Region: 2-152
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 1.7e-31
Family Tubulin, GTPase domain 0.00021
Further Details:      
 
Domain Number 2 Region: 189-370
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 7.94e-16
Family Tubulin, C-terminal domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Batde5|89091|GP3.046500
Sequence length 377
Sequence
MGTSGRGNNWSHGFLEESKLDQILDSFRRLAEASFRYDGCMITHSLAGGTGSGLGSRMAL
ELRDLYPKNYIMSCSFAPFSSGETALQNYNALLTLASLQSSADFIGVFSNDAILNTVTKQ
LGLDSSRNTPCVSIDTLNYWASQTLAGIMLPISPVSLDPINFCDNSLNRYTGQESNKVVV
SDSVKPFSGWDLITRVTPMPSMKLAMFSSSQSIYTASKNIPKHAHTIDSWEDHFTQLHRN
MSLPVGHRRNCIGAQLNIRGVQGVEFWKRWPEMQSKWLLKLGLSTPNTCLDVRMSYIYGL
DMHSKQRSLDLCYNSDDIVPIVKKVYDQALHMYSQRAYVHWYERYMQSRTDEMFSESFEA
VNSILDSYSTLSTNHLL
Download sequence
Identical sequences A0A177WFB6 F4P4F1
BDET_02735 jgi|Batde5|89091|GP3.046500 XP_006679724.1.45406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]