SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296126444|ref|YP_003633696.1| from Brachyspira murdochii DSM 12563

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296126444|ref|YP_003633696.1|
Domain Number 1 Region: 31-138
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000222
Family Collagen-binding domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296126444|ref|YP_003633696.1|
Sequence length 280
Comment hypothetical protein [Brachyspira murdochii DSM 12563]
Sequence
MKYKLIIILLLVIISCINNSKENNIISVNRDEIEPNDSFEYSQFIDTSTFINASFQSDED
IDYYQIKPTNSSVMNLSVYANKLDINLTLMSSSNSNVININTKYIENYRGFIELKDFMFY
DDSYFLKLSSDKEGKYDLRFEFKNDYFPSNEIEPNNNINAANIINYPNELFYGYFLYNDF
YSNNFNIDENIKPYIKNSDITDIDFYEIRNDTDINTSINIILEYSKDIDMLLFDENYNYI
KKGINKLSTSFKSGSKYYIALVCFGSKSIIERYTLHYEFN
Download sequence
Identical sequences D5U9X4
gi|296126444|ref|YP_003633696.1| WP_013113916.1.81496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]