SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298674844|ref|YP_003726594.1| from Methanohalobium evestigatum Z-7303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298674844|ref|YP_003726594.1|
Domain Number 1 Region: 286-572
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 4.71e-145
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.000000000329
Further Details:      
 
Domain Number 2 Region: 5-285
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 4.71e-141
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00000000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298674844|ref|YP_003726594.1|
Sequence length 573
Comment methyl-coenzyme M reductase subunit alpha [Methanohalobium evestigatum Z-7303]
Sequence
MVDKDKERRFKKELERKFTQEFGDNKQSGGEITDKKTEYQRMGVAQSPRKMEMLKAGQEL
SKKRGLVGYNPDLHAGGVQLGQRALTPSYLSGTDMLTEMDDLHYVNNAAMQQMWDDIRRT
CIVGMDSAHETLEKRLGIEVTPETINHYLEVLNHAIPGGAVVQEHMVETHPGLTEDCYVK
IFTGDDDLADEIDDQFLIDIDKEFPEDQAQQLKESIGKTTWQVAHIPTVVSRTTDGGQTR
RWMAMQLGMSFINAYHMCAGEAAVADLSYAAKHASVINMGEMLPARRARAENEPGGIPFG
HMADIIQTSRAYPDDPAKTALEVVGAGCMLYDQIWLGSYMSGGVGFTQYATAAYTNNILD
DNLYYDIEYINDKYNNAGKPGADNKAPATMDVVKDIATESTLYGLENYEKYPTALEDHFG
GSQRATVLSAAAGSATSIATGNSNAGLSAWYLSMYLHKEAHGRLGFFGFDLQDQCGAANV
FSYQSDEGLPLELRGPNYPNYAMNVGHQGGYAAITSGAHAGRGDAFATNPLIKIAFADDL
LPFDFKEPRREFGRGALREFKPAGERSLIIPAE
Download sequence
Identical sequences D7E8X7
WP_013194366.1.99978 gi|298674844|ref|YP_003726594.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]