SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298674848|ref|YP_003726598.1| from Methanohalobium evestigatum Z-7303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298674848|ref|YP_003726598.1|
Domain Number 1 Region: 186-432
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 1.1e-128
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.00000000268
Further Details:      
 
Domain Number 2 Region: 1-185
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 1.53e-73
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.000000354
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298674848|ref|YP_003726598.1|
Sequence length 434
Comment methyl-coenzyme M reductase subunit beta [Methanohalobium evestigatum Z-7303]
Sequence
MADNIDLYNDRGKLLESNVDLMDIAPTKNDAIKKIIDDTKKSVAINLNGIQKALSTGKMG
GKGRHIPGYELDYDLVGNADSIRDSVEELVRVDPNDDTNVESLYGGKQLLIQVPDERLQA
GADYASATTVGAAATVQSIIDKFNTDMFVAPIVKAAVWGSYPQTVDLSGGNIASILKIPQ
QNEGLGYSLRNIMTNHIVAITNKKAMNAACLSSIYEQVAMYEMGNAVGEFERQQLLGLAY
QGLNANNLVYDIIKDNGKDGTIGTVIDSTVNRALEDNVISVDKTAPSGYSFYKANDVPMW
NAYAAAGQLAASMVNCGAGRSPQNVSSTLLYFNDIIEKETGLPGCDYGRVQGTSVGFSFF
SHSIYGGGGPGIFNGNHIVTRHSRGFAIPCVAASASLDAGTQMFTPEATSSLIGDVFGSI
ETFREPIDAVAKAL
Download sequence
Identical sequences D7E8Y1
gi|298674848|ref|YP_003726598.1| WP_013194370.1.99978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]