SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298674970|ref|YP_003726720.1| from Methanohalobium evestigatum Z-7303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298674970|ref|YP_003726720.1|
Domain Number 1 Region: 13-125
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 1.18e-18
Family MRR-like 0.053
Further Details:      
 
Weak hits

Sequence:  gi|298674970|ref|YP_003726720.1|
Domain Number - Region: 167-242
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0432
Family YVTN repeat 0.06
Further Details:      
 
Domain Number - Region: 261-318
Classification Level Classification E-value
Superfamily PH domain-like 0.0984
Family VPS36 N-terminal domain-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298674970|ref|YP_003726720.1|
Sequence length 340
Comment restriction endonuclease [Methanohalobium evestigatum Z-7303]
Sequence
MSQWSIEHLLQMDPYDFEKLVAYLFTNMGYKAEVTNQSRDDGVDVVLKLEKFGLSHKWLV
QAKRYSKTVGVKEIREYSSLRYQDDVEGIIVVTTDEFTDDAKTEAKKHNLKLIEGGLLVE
MLNYYCPDGQEEPEDIISENSENLSIADDVILKNDESVMANEPAVVKGQKLMVAVTNKNI
YLIKKTLGIFSRKTDIYRQINVNNIVGIHTNNREIYLLTGQNGDIEIFNIHPKKPEKLFE
TFSNLKAEYTKGEYLLKFEIKKEGYLILTSKRLMDLNSDNEVEGEFNLKNIVGTGVTNTG
LFKKQKLVVWFSSDKVNKYEIDVDNVQEWQNSINGAVKTV
Download sequence
Identical sequences D7E7H5
gi|298674970|ref|YP_003726720.1| WP_013194491.1.99978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]