SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298675453|ref|YP_003727203.1| from Methanohalobium evestigatum Z-7303

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|298675453|ref|YP_003727203.1|
Domain Number - Region: 217-315
Classification Level Classification E-value
Superfamily ADP-ribosylation 0.0432
Family ADP-ribosylating toxins 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298675453|ref|YP_003727203.1|
Sequence length 426
Comment IS605 OrfB family transposase [Methanohalobium evestigatum Z-7303]
Sequence
MLLTKKYKIKPTNEQLDVLWSLSKQCTLLYNLSLSERKEAWMHKRKSIKYSHQQDNLPSL
KDQYPSIYSLYSKTCQGVLQKLDANYKSFFGLRKNGDKNAKPPRFKKSVYFFTIPYNQSG
FKIENGKVTFSHKYNNRPLSFDIPQELENYDVKHTEIFNSEPYKGKGDFFVSVVYETFPQ
TNYKDNEKYQAIDIGITKTITAVNTDGKILEITNPRFDKYWDKKINHAKSRRDHCKKYSR
RWFRINDAIRVMTKKKNNQIKDWQHKLSRKMAENTRSNTIIVGDLDVKNMKNSKKLPKSR
QKSLNRSTQNNGYISRFIEFLTYKSEFAGKQLTKIDESYTSKICYVCGKVHDMPLYKRNL
SCDCGNEIDRDRNSAINIMISYLSQNAIWTGYRQFACNLRQTGLLTFDVYKIHPMDDMNT
RRNFHV
Download sequence
Identical sequences D7E9Y5
WP_013194972.1.99978 gi|298675453|ref|YP_003727203.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]