SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298675611|ref|YP_003727361.1| from Methanohalobium evestigatum Z-7303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298675611|ref|YP_003727361.1|
Domain Number 1 Region: 1-277
Classification Level Classification E-value
Superfamily F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) 6.67e-118
Family F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) 0.000000348
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298675611|ref|YP_003727361.1|
Sequence length 277
Comment methylenetetrahydromethanopterin dehydrogenase [Methanohalobium evestigatum Z-7303]
Sequence
MVKVGFIKLGNLGMSQVVDLLEDEIAAREGITTRVYGTGPKMSKEDAADTEAFKEEFDPD
FVIIISPNASTPGPTEARQLWKDKPCLIISDGPTKKDDRQAIEDEGFGYIILPVDPLIGA
KTEFLDPEEMASFNSDVMKVLSTCGAVRLVQEELDKLTSQVDEGKSGDEIEMPHIYAKPQ
TCIERSGFSNPYAKAKALAALHMAEKVSQINLPACFMLKDLEEVAFTAATGHEMIRAAAE
LAVEAREIEKTNDTVLRKPHSKKGKVLSKTKLYEKPQ
Download sequence
Identical sequences D7EB48
WP_013195130.1.99978 gi|298675611|ref|YP_003727361.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]