SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298676161|ref|YP_003727910.1| from Methanohalobium evestigatum Z-7303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298676161|ref|YP_003727910.1|
Domain Number 1 Region: 6-108
Classification Level Classification E-value
Superfamily Cell growth inhibitor/plasmid maintenance toxic component 0.0000000000000698
Family Kid/PemK 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298676161|ref|YP_003727910.1|
Sequence length 110
Comment hypothetical protein Metev_2299 [Methanohalobium evestigatum Z-7303]
Sequence
MERFVKGDVVVLPFPFSDMSNSKKRPALVLANLQGEDIILCMITSAVKIDNYSITLNDND
FEYGTLRKNSNIRPNRIFTADKSLILYKVGYLKNDKTDEVEKKLVNIFTS
Download sequence
Identical sequences D7EBZ2
gi|298676161|ref|YP_003727910.1|NC_014254 WP_013195679.1.99978 gi|298676161|ref|YP_003727910.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]