SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298676217|ref|YP_003727966.1| from Methanohalobium evestigatum Z-7303

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|298676217|ref|YP_003727966.1|
Domain Number - Region: 77-123
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000667
Family Classic zinc finger, C2H2 0.061
Further Details:      
 
Domain Number - Region: 142-183
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00923
Family Plant C2H2 finger (QALGGH zinc finger) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298676217|ref|YP_003727966.1|
Sequence length 203
Comment zinc finger C2H2-type domain-containing protein [Methanohalobium evestigatum Z-7303]
Sequence
MSVCKNCGKKPNHFGFCQQCGTRSYVVSDEKYQSFIKNRPSHPSKVVTHEIVNSSVPSEV
GKRKKTTSGGKNKKHNHICGICSSEFDGKNKLINHMEKKHGLEFTCEYCSRKFISEHALN
QHKNDVHHTSKESLISTFDSKNKLIHMEKKHSLEFTCEYCSRKFISEHVLNQHKNDVHHA
FKESLITSKESLISNIDENQMAL
Download sequence
Identical sequences D7EC48
gi|298676217|ref|YP_003727966.1| WP_013195734.1.99978 gi|298676217|ref|YP_003727966.1|NC_014254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]