SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298674192|ref|YP_003725942.1| from Methanohalobium evestigatum Z-7303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298674192|ref|YP_003725942.1|
Domain Number 1 Region: 8-36
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000326
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298674192|ref|YP_003725942.1|
Sequence length 38
Comment zinc finger C2H2-type domain-containing protein [Methanohalobium evestigatum Z-7303]
Sequence
MGDKSEKKENKFECKVCEMTFPTRQDYERHMKKHHESG
Download sequence
Identical sequences D7E6C4
WP_013193714.1.99978 gi|298674192|ref|YP_003725942.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]