SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298674344|ref|YP_003726094.1| from Methanohalobium evestigatum Z-7303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298674344|ref|YP_003726094.1|
Domain Number 1 Region: 670-834
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.37e-46
Family Histidine kinase 0.0003
Further Details:      
 
Domain Number 2 Region: 345-467
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.09e-25
Family Heme-binding PAS domain 0.039
Further Details:      
 
Domain Number 3 Region: 466-590
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.08e-25
Family Heme-binding PAS domain 0.0067
Further Details:      
 
Domain Number 4 Region: 599-681
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 7.26e-21
Family Homodimeric domain of signal transducing histidine kinase 0.0015
Further Details:      
 
Domain Number 5 Region: 33-167
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.13e-20
Family Heme-binding PAS domain 0.08
Further Details:      
 
Domain Number 6 Region: 188-369
Classification Level Classification E-value
Superfamily GAF domain-like 8.07e-20
Family GAF domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298674344|ref|YP_003726094.1|
Sequence length 837
Comment multi-sensor signal transduction histidine kinase [Methanohalobium evestigatum Z-7303]
Sequence
MIGGCINHLTFLLSTSPIKVENESKVLVNFLDISERKKVQEDLRKEKKFFERVAETSPIS
ITHLDKSGNIIYANHTAEKVLGLSKNDINRRTYDDVKWKITDYDGNDFPQDELPFELVKK
YHQPVYDVQHAIEWKNGKRIYLSINAAPIFDKYGNFDGMIAAIEDITKQKNTESNLEHAL
YNSHEREKEINELLNATRTILEVNDFNTAARYIFDSCSRLLGAKAGYVSLLSDTGDENEI
LFLEDGGMPCSVDIDLPIPVRGLSAEVSRTGDVVYDNDFMNSNRVKYMPECHMNLPNVLI
SPLTVDGKTLGFMGFAYKEGGFTDNDAQLAKTFGEYAAIALKNSKAFQALEKSEERYRSI
FETAASLITSVDENGTIVDCNNQIKNILGYEKEEVIGQSMTKIIHPDYVNKSFEILHEIL
NYGFSYNKEYKMVRKDGELIDVLINSSGVDKINGNYSRTICIINDITKSKEFEHELKKSE
EKFRKVTEQAADVIIAYDFDGNILYVNNLACEKLGYTKNELLSMNITDIDPENNIETYRK
YWYGLSQNNSVHIETSRKRKDGSVYPAELRMTLIDLNGKPVILGFSRDMTVQKEAEENLI
NAKLEAEAASQAKSDILANVNHELRTPLTSIIGFSDVLLKGKAGDLNESQKMYLSRVHNN
GKHLLDLITDILDLSKIESGKSGLNYERISIIELVNDLKEYIQPFVSNKVLILHSRVDSG
LNYIYADYIKIKQILSNLLYNAVKFTEEGSITLEVSQNEDDVQFSVIDTGIGIPKGSHEA
IFDSFKQLDSGPARKYQGTGLGLALVNKLVNMHGGQIWVESEIKKGSRFTFTIPDNR
Download sequence
Identical sequences D7E6S6
gi|298674344|ref|YP_003726094.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]