SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296131864|ref|YP_003639111.1| from Thermincola potens JR

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296131864|ref|YP_003639111.1|
Domain Number 1 Region: 50-171
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 4.45e-45
Family Insert subdomain of RNA polymerase alpha subunit 0.0000239
Further Details:      
 
Domain Number 2 Region: 5-54,146-230
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 1e-32
Family RNA polymerase alpha subunit dimerisation domain 0.00081
Further Details:      
 
Domain Number 3 Region: 247-312
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 1.44e-24
Family C-terminal domain of RNA polymerase alpha subunit 0.0000629
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296131864|ref|YP_003639111.1|
Sequence length 315
Comment DNA-directed RNA polymerase subunit alpha [Thermincola potens JR]
Sequence
MLEIEKPKIECVELSEDNTYGKFVVEPLERGYGITLGNSLRRILLSSLPGAAVTSVKIDG
VLHEFSTVPGVYEDVTDIILNLKELCLKMYTDEEKVLRIESEGPGEVKAGNIITDADVEI
LNPELHIATLSDDARLVMEINVAKGRGYVPAERNKKDDHVIGIIPVDSAFSPVRRVNYYI
EDTRVGQITDYDKLTLEVWTNGSIRPDEATSLSAKILSEHLRLFIGLTENIKDVEIMVEK
EEEEKDKILEMTIEELDLSVRSYNCLKRAGINTVEELTQRTEEDMIKVRNLGKKSLEEVI
NKLAELGLSLKKSED
Download sequence
Identical sequences D5XAB1
WP_013119234.1.83787 gi|296131864|ref|YP_003639111.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]