SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|564288066|ref|YP_008874265.1| from Haloarcula hispanica N601

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|564288066|ref|YP_008874265.1|
Domain Number 1 Region: 20-203
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 3.14e-42
Family NADH oxidase/flavin reductase 0.0000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|564288066|ref|YP_008874265.1|
Sequence length 205
Comment NAD(P)H-flavin oxidoreductase [Haloarcula hispanica N601]
Sequence
MSQTYYSRSLDDEISEHRDPAHDVDPLFVNRWSPRAMAGDSLAEDDLLPLFEAARWAPSA
FNNQHWRFVYATREDDEWESFLGLLNEANRSWARNAGALIAVFSKVTLEHNGESAGTRSF
DTGAAWQNLALEGARRDLAVHPMAGFDWDRIHEALGVPEDEFDAEAMIAVGERADPETLP
EDLKEHEKPSGRKPLDEIVFSGQFE
Download sequence
Identical sequences A0A0B5GZ01 G0I030 V5TU69
WP_014031109.1.27393 WP_014031109.1.67629 WP_014031109.1.92404 WP_014031109.1.92869 gi|344210059|ref|YP_004786235.1|NC_015944 gi|564288066|ref|YP_008874265.1|NC_023012 gi|564288066|ref|YP_008874265.1| gi|344210059|ref|YP_004786235.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]