SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|564288635|ref|YP_008874846.1| from Haloarcula hispanica N601

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|564288635|ref|YP_008874846.1|
Domain Number 1 Region: 141-272
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 2.26e-43
Family CTP-dependent riboflavin kinase-like 0.00012
Further Details:      
 
Domain Number 2 Region: 53-135
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000554
Family MarR-like transcriptional regulators 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|564288635|ref|YP_008874846.1|
Sequence length 274
Comment riboflavin kinase [Haloarcula hispanica N601]
Sequence
MYPVETVRRASATNPVPVFLHSKSGMHSTFGMLIRRESLLQCMAESTGQGVGRDELATLK
LLALDGALDESAKVSCADLAERLDASNQTASRRLQRLEDAGLLARDIVSDGQEVELTGDG
ERRLQSEYADYRRIFESDASVDLTGVVTSGMGEGRHYITLPGYMEQFIERLGYEPFAGTL
NLELTAESVRKRARMSAIEPVTIEGWEDDERTYGPAYCYPASIEGSDGEYEPAHVIAPER
THHGEEQLEVIAPEKLREVLELADGDEVIVHVSE
Download sequence
Identical sequences V5THL5
gi|564288635|ref|YP_008874846.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]