SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|564289379|ref|YP_008875619.1| from Haloarcula hispanica N601

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|564289379|ref|YP_008875619.1|
Domain Number 1 Region: 12-216
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 1.07e-52
Family NADH oxidase/flavin reductase 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|564289379|ref|YP_008875619.1|
Sequence length 223
Comment cob(II)yrinic acid a,c-diamide reductase [Haloarcula hispanica N601]
Sequence
MVEFGPRDREAVYKSIYSRRDIRRFAADSVPEDVLTRVLDAAHNAPSVGFSQPWDFVVIE
DEQTKSAVAAIAERAIAAAREGYEEPRKSDFGQLKLEGITDAPVNICVTCDPTRAAPHVL
GRNTMRRMDVYSTCLAVQNLWLAARAEGIGVGWVSFLYPHELRAVLNIPHHVQPVAYLCV
GYPEDGFPAEPVLQREGWRNRIDRTELVHYDEWDPSRTPETKS
Download sequence
Identical sequences A0A0B5GWQ0 A0A165M1N9 G0HXI9 V5TLG9
WP_014040001.1.13069 WP_014040001.1.27393 WP_014040001.1.67629 WP_014040001.1.92404 WP_014040001.1.92869 gi|344211389|ref|YP_004795709.1| gi|564289379|ref|YP_008875619.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]