SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296241800|ref|YP_003649287.1| from Thermosphaera aggregans DSM 11486

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296241800|ref|YP_003649287.1|
Domain Number 1 Region: 177-524
Classification Level Classification E-value
Superfamily HydB/Nqo4-like 3.14e-115
Family Nqo4-like 0.000011
Further Details:      
 
Domain Number 2 Region: 13-182
Classification Level Classification E-value
Superfamily Nqo5-like 1.23e-28
Family Nqo5-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296241800|ref|YP_003649287.1|
Sequence length 545
Comment NADH dehydrogenase subunit C [Thermosphaera aggregans DSM 11486]
Sequence
MLRNTSIIDKYVKLAESANASIMVDGDTIHIVAKPEYIPGLAGKLFNEFKCVHRTCVATD
ERPLNGFFSLTHLFTDDSNGFYVALKTYLEGDKPRAPSIIEQVPAADWCEMEARDLVGIE
FEGRSAYRLVLPPGWPSDVYPLRKDFQYDKRPSILPVSEKITITEESSTVPVGPYHPALH
EPEYFELYVEGEKVVDVKYRGFHVHRGIEKLGESRMTYQQVNFLAERICGICGFEHSTCY
ALAVEKAAKLDVPERAQFIRSIILEVERLHSHLLWLGVAFHLVGYDAGFMHMWRIREKVM
YLSEYLTGSRKTYGINLVGGVRKDINEEKKPKILETLDTLEKEFKELVGIATSVPQVKRR
LTGTGILPREDAVKLGVEGPVARASGVDRDARRDLPYAAYKHVSFKVPVYTEGDNMARTL
VRVDEVFESISMIKQLLDQMPKGPIRLEEFDIPPGKIGVQVVEAPRGGDIHFVVTGEGKP
YRWRVRAPTYNNIPALRVMLRDQPLADAPLTIASIDPCFSCTDRVVVIREDGSVYKLSLV
EGVKL
Download sequence
Identical sequences D5TZN5
gi|296241800|ref|YP_003649287.1| WP_013128928.1.1770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]