SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296241820|ref|YP_003649307.1| from Thermosphaera aggregans DSM 11486

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296241820|ref|YP_003649307.1|
Domain Number 1 Region: 164-362
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 0.00000000000000213
Family FolH catalytic domain-like 0.031
Further Details:      
 
Weak hits

Sequence:  gi|296241820|ref|YP_003649307.1|
Domain Number - Region: 58-161
Classification Level Classification E-value
Superfamily PA domain 0.000124
Family PA domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296241820|ref|YP_003649307.1|
Sequence length 533
Comment aminopeptidase Iap family [Thermosphaera aggregans DSM 11486]
Sequence
MSEVIAGTRSESKIIRGLRSQLSDHVDWVDVLKTPVKTWIPEECSITIDTEDFECTPIPY
SLTSETEGYLVFEENIQPGAGNIVLMRYPENYFATSIRVHEAFRKGVSAVILFEKDEHVT
RKIAVTDPPYPSNMPGNPPPIPVVTIDHEVFRALERRLRISGGLKATVKVGAILKDSIGY
TLIAGINGSGESEVHVTTHHDHWFQGEGDSIVGLKTLLALAKQWRTVENKVNILLISFTA
KELGSPYLSPYHWSWGSKYFLQVMRNKALLENTLYSIVIDSVHVNTPTVYYHPSLYKVVV
ESLKPGWNAVPGGNHYSLDSLTYLREGIPSMAITTLSNEYSWKIHYSSLDNPINVNSDSI
AVELSGFLVKTILASKSEEITVNNLWDYISLDNYPLEFKTIVAKARQAESVIGSRSVLRI
TTKTFSDCALLRINDHAIFHAGLLSPLLLAEEAGRRIGEEEIFLKLQLCSGRSYSFFFAR
HNKRFVKETLSKIVDDIVSLLSDEFNYEYNFKLFSTFDRIQGGAGGEAGANRS
Download sequence
Identical sequences D5TZQ5
WP_013128948.1.1770 gi|296241820|ref|YP_003649307.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]