SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296241892|ref|YP_003649379.1| from Thermosphaera aggregans DSM 11486

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296241892|ref|YP_003649379.1|
Domain Number 1 Region: 8-98
Classification Level Classification E-value
Superfamily SRP19 2.09e-28
Family SRP19 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296241892|ref|YP_003649379.1|
Sequence length 99
Comment signal recognition particle subunit SRP19 (srp19) [Thermosphaera aggregans DSM 11486]
Sequence
MSREYRGRKIVLYPSYIDSTFSRGEGRRIPSALAVPSPSIEEIYNAAVKLGLNPVVENDK
AYPGKWWVKGRVVVDKKYSKTTLLRKIAIEIKENRARKH
Download sequence
Identical sequences D5TZX7
gi|296241892|ref|YP_003649379.1| WP_013129020.1.1770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]