SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296241956|ref|YP_003649443.1| from Thermosphaera aggregans DSM 11486

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296241956|ref|YP_003649443.1|
Domain Number 1 Region: 43-172
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.000000000254
Family ATP-dependent protease Lon (La), catalytic domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296241956|ref|YP_003649443.1|
Sequence length 572
Comment serine protease [Thermosphaera aggregans DSM 11486]
Sequence
MKPIHMIALLMCLASTLTGVGEHVSKESFTYKLSLLAVDNEGRGRIVDVYITVSTPGRGV
ITVIPSNAFSQDTLLSFKLALLYASLLTGEDYRRLDYTISVQGLAQVEGTSATLLFTIFA
ISLLRNESFDSLKSATGIIGPGGIVGRVGGVAQKVEAAKSYGLKLVTGPFSSNISDEIYQ
PVLTVFQAYEKFSQKSLFPELNYEYLYAPSLSSYFKEVWMNFYNKTNQIIASLNNSMWTD
SFLEKSLNLLNLSTNYAEVKHYYTASSIAFQAYYYGYSSLLNYSYHTSLPEFENNISAIR
NKVREARLFIEQQSRLETCYNPLIIDLYVNALKRIEESEEAVKAADESIELIYKIGNYSY
SIARAETSLAWVNASNVYERRNCIAVSLLNTYLTRMQELLSTSISYYTAMSYLSGFEPIP
STGNTFLDLIYTLKALEKMAEQLYANPALIKNEIFPVLGSPSIKEFLLNSLKSLSIYVMN
KLGLVIPSSITMTEFLTDASSMDYITESLIIQIMTLHAYIYSFLVFTLSEPVEYGPTYLF
DPTMVPNSLIPFLVILCTAGFSLVILSLNRED
Download sequence
Identical sequences D5U041
gi|296241956|ref|YP_003649443.1| WP_013129084.1.1770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]