SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296242139|ref|YP_003649626.1| from Thermosphaera aggregans DSM 11486

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296242139|ref|YP_003649626.1|
Domain Number 1 Region: 4-229
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.92e-68
Family ABC transporter ATPase domain-like 0.0000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296242139|ref|YP_003649626.1|
Sequence length 240
Comment ABC transporter-like protein [Thermosphaera aggregans DSM 11486]
Sequence
MSEIIKLINVKKVYRVGSVETVALKGVSMSISKGDLLSIMGPSGSGKTTLLNMIGLLDKP
TEGNILVEGVDVTRLTSDQIADIRNRKIGFVFQQFNLINRLTVLENIELPLIARGVPRNI
RVKKAVEALRLAGGDESWLRKRPSQLSGGQQQRVAIARALVGSPELILADEPTGNLDRKS
ARLVVETFLKLNESGIAVCVVTHDPEIANCTRKVFIIRDGSIMSVEEPDKDKCILHTVQG
Download sequence
Identical sequences D5U0M4
gi|296242139|ref|YP_003649626.1| WP_013129267.1.1770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]