SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296242167|ref|YP_003649654.1| from Thermosphaera aggregans DSM 11486

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296242167|ref|YP_003649654.1|
Domain Number 1 Region: 270-411
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 3.53e-20
Family Intein (protein splicing domain) 0.028
Further Details:      
 
Domain Number 2 Region: 408-539
Classification Level Classification E-value
Superfamily vWA-like 0.00000000000153
Family Integrin A (or I) domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296242167|ref|YP_003649654.1|
Sequence length 568
Comment Hedgehog/intein hint domain-containing protein [Thermosphaera aggregans DSM 11486]
Sequence
MEEQVRGVLKGIDYQNPLTIYRGERIRRIIDFLGGKGEKIPLDLAIDTFYVFYLPFPILS
EDADPSNRNYQVVKYLMKSPSLHSIKGKTLIDPFMSGLAASVFLSEYESLEEAQRSRHSR
STDNSEESRDASEVRRIVEKAIVNTMMDVEHVRRLKSVMEGLEPGSISQLSFEEYGPELL
RLARTTDVRRILELIEGLKPWELGLKKKSERHKHGEIGGYEPGRDIERLTPSSRILPDEL
FYLRFLSSRLLLYEKRVEESLGPIYVLLDKCLDGESLVELSNGRLKKLREIRVGDEVVSA
KISSKGVPVVSSAEVVEIVEDVKPVYGLKTEAGVLKASGNHVIPVFQNSSTILKQASEVQ
PGEHLYAYDYRESGFKPVRLLEKMMLGVEKVFDIRLGKDHFFTANGVLVHNSGSMDGVKI
TWAKAVALGLYIRAVREHREFYVRFFDSQPYPLIKVGRRPKAREVVELMNYIARVKGSGG
TDISRALITASTDIRTGASGETSDIILITDGVDRIAEQHVSYNLKRAGANLYSVMILGEN
PSLKKVSTKYFSVTRLGRSSALKIIEVR
Download sequence
Identical sequences D5U0Q2
WP_013129295.1.1770 gi|296242167|ref|YP_003649654.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]