SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296242525|ref|YP_003650012.1| from Thermosphaera aggregans DSM 11486

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296242525|ref|YP_003650012.1|
Domain Number 1 Region: 311-473
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.82e-54
Family DNA gyrase/MutL, second domain 0.00000317
Further Details:      
 
Domain Number 2 Region: 19-230
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.23e-35
Family DNA gyrase/MutL, N-terminal domain 0.000000303
Further Details:      
 
Domain Number 3 Region: 234-305
Classification Level Classification E-value
Superfamily S13-like H2TH domain 0.00000000000222
Family Topoisomerase VI-B subunit middle domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296242525|ref|YP_003650012.1|
Sequence length 532
Comment DNA topoisomerase VI subunit B [Thermosphaera aggregans DSM 11486]
Sequence
MSNSVEGVEKYRAISPAEFFYKYREIAGFSNPVRALYQTVRELYENALDATDAHGILPDV
KISIKRVDEIQEYYRVTVEDNGIGLPPDVVPNAFGKVLFSSKYVLKQTRGMYGLGVKMAV
LYGQMTTGRPVEVITSKQGFKRIYYFKLRIDVNKNEPVILERGTWRKSRDWHGTIVSITL
EGDWARAKPKIMEYLSRSVVVTPYANIIFLTPENEIIYYPRAISILPRPPVEVKPHPFGV
DLEMMKQLKELSASDTVKDLLIKNFQSVGESTATEVLNRAGVDPSKPAGSLGEDELLRIV
NAIKGFENLRPPSAKAISPLGREIIVTGLSRMFKPEFVEAVTRRPQVYHGHPFIVEAGVA
YGGGTPQSEMDKPVILRYANKIPLLYDEGSDVTTFVIKEDINWANYSIAFPAPLVVLVHV
CSTKIPFKGVGKESIADVPEIRREIRLALMEVLRRLKIYLVRKAREEEVKRRVVLLAKYI
PEIARSLHTIVRGEDGIDQELLKQKLVEIVAKRAGLSLEEVARSVETVEIGT
Download sequence
Identical sequences D5U1R0
gi|296242525|ref|YP_003650012.1| WP_013129653.1.1770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]