SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296242719|ref|YP_003650206.1| from Thermosphaera aggregans DSM 11486

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296242719|ref|YP_003650206.1|
Domain Number 1 Region: 15-197,245-357
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.15e-45
Family tRNA pseudouridine synthase TruD 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296242719|ref|YP_003650206.1|
Sequence length 363
Comment tRNA pseudouridine synthase TruD [Thermosphaera aggregans DSM 11486]
Sequence
MTYYPHPLDYVAGLKHVLTHRKIRAELEITPDTFNVEEIVNFQELGFDKGKGDYAVFRVV
KRSIDSLRVKRYLAKQLGIPESNILHLGLKDKESTSTQHFFVKKTLISRELRELHGENFT
AILIGFTRVKPTRKSLVGNKFKVRLETTSTSDYHTAEDLLKLVATSGLPSYYGYQRFGVE
RPISHLLGKQIILKREDRFSTLFLRDHYPWENPNSVTARVKGFIPRKLFYEKLYVESPLS
KGLELVDKSTSKILVEAYASYLYNLLLNKLIDTCGWECLNRELPTPGCNSGELPLYMEIF
EKEGLNPESAVQLGCWWRAGLFKPFDISLRLVNNILEIGFSLGQGFYASVVLRELFKENL
VLK
Download sequence
Identical sequences D5U2A4
gi|296242719|ref|YP_003650206.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]