SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296242917|ref|YP_003650404.1| from Thermosphaera aggregans DSM 11486

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296242917|ref|YP_003650404.1|
Domain Number 1 Region: 4-77
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 7.52e-21
Family eIF5a N-terminal domain-like 0.00023
Further Details:      
 
Domain Number 2 Region: 69-131
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000163
Family Cold shock DNA-binding domain-like 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296242917|ref|YP_003650404.1|
Sequence length 132
Comment translation initiation factor 5A [Thermosphaera aggregans DSM 11486]
Sequence
MSKNYETLGNLKPGSFIIIDGEPCRIVEISKAKTGKHGSAKANVVAISLFTGNKKTLVAP
ADSQVEVPIIDKRVGQIIADMGEQFQLMDMESFETFEVDKSSVEEDLRNKLKVGSEVEYW
VVMGKRLIIRLR
Download sequence
Identical sequences D5U2V2
WP_013130045.1.1770 gi|296242917|ref|YP_003650404.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]