SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296243059|ref|YP_003650546.1| from Thermosphaera aggregans DSM 11486

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296243059|ref|YP_003650546.1|
Domain Number 1 Region: 8-176,206-220
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.58e-47
Family Ribonuclease PH domain 1-like 0.00000366
Further Details:      
 
Domain Number 2 Region: 192-276
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.93e-20
Family Ribonuclease PH domain 2-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296243059|ref|YP_003650546.1|
Sequence length 289
Comment ribosomal RNA-processing protein RRP42 [Thermosphaera aggregans DSM 11486]
Sequence
MSITPVKEPILPKAQAEAIIKLLKKGERIDGRGLLDYRPINVYLNPIEKADGSSHVILGT
TQVITGVKIELGEPFADRPDEGVLQVHAEFVPLASQTFEPGPPDENSIEVARVVDRSLRE
PKAIDFKQLVVAPGKKVWVVFNDIYLIDHGGNIMDASMLSSMLALATAKIPYYEEKEPGV
YVVDNKRHTSPLPVNTLVATVTMGIHEDVIIVDPSIEEEVVLNTFLTIAVDEKGRVCGIQ
KKGIAGLSKKMLDQAVEIALNKGGFLIDLIRKILNNPSDYMKPLETNQY
Download sequence
Identical sequences D5U394
gi|296243059|ref|YP_003650546.1| WP_013130187.1.1770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]