SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296243116|ref|YP_003650603.1| from Thermosphaera aggregans DSM 11486

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296243116|ref|YP_003650603.1|
Domain Number 1 Region: 11-141
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.83e-35
Family Translational machinery components 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296243116|ref|YP_003650603.1|
Sequence length 141
Comment 30S ribosomal protein S9 [Thermosphaera aggregans DSM 11486]
Sequence
MSETVVEKYKIVVASGKRKTSIAKAVVKPGIGRVWINGIPLEIFPVELARVKMMEPLMLV
GDLWRKVDIKVEVRGGGVMSQAEAARTAIARGLLEYVNNDEEVKKIFTEYDRHMLSGDPR
RTESEKWGRYSARRRWQKSYR
Download sequence
Identical sequences D5U3F1
WP_013130244.1.1770 gi|296243116|ref|YP_003650603.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]