SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|298346696|ref|YP_003719383.1| from Mobiluncus curtisii ATCC 43063

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298346696|ref|YP_003719383.1|
Domain Number 1 Region: 19-264
Classification Level Classification E-value
Superfamily Cgl1923-like 1.16e-73
Family Cgl1923-like 0.00000968
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|298346696|ref|YP_003719383.1|
Sequence length 349
Comment hypothetical protein HMPREF0573_11570 [Mobiluncus curtisii ATCC 43063]
Sequence
MDADKFDSLLAPGADFSGHADVMLHHLNGAMDAGHSGRGMLEHLVEALPHQTIATFNSDK
LVDFRSHRPWLSFSDWKFTEVEMPEIRLDLLSDDNDRNFLVLHGPEPDAQWNLFLETIQE
IVRRLGVRQTVGVTGMPAGVPHTRPTPVHLHGARSESLPKQPKMVGEMILPAGMDQLIEF
TLGQTGLDAVGIIAAVPYYLAEGDYPPAAAALMSAVAAKTGLALPVGDIEAASALTLGQI
NQMVEQSEEAGHIVEILEQHFDEAEPMAIIETPEEPLPTAEELGARLEEFLKRADRLNRG
AKLSNLNEESLPVADASGISSLRDTPYEKRNIERLRPRRGRHRRDTPED
Download sequence
Identical sequences D6ZGY1
WP_013189478.1.70285 gi|298346696|ref|YP_003719383.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]