SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|304310443|ref|YP_003810041.1| from gamma proteobacterium HdN1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|304310443|ref|YP_003810041.1|
Domain Number 1 Region: 190-382
Classification Level Classification E-value
Superfamily Bactericidal permeability-increasing protein, BPI 0.00000141
Family Bactericidal permeability-increasing protein, BPI 0.007
Further Details:      
 
Weak hits

Sequence:  gi|304310443|ref|YP_003810041.1|
Domain Number - Region: 820-894
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0573
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number - Region: 727-848
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0746
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|304310443|ref|YP_003810041.1|
Sequence length 896
Comment hypothetical protein HDN1F_07990 [gamma proteobacterium HdN1]
Sequence
MMWQRTFKQCLFVLLALGLAACKQYTIVDPTANALFTTPPPQYTVSYGAKPATAPKMTLN
GYEVQKFFVLGDKQAIAQGADLATFLKEGYNIFQVSPPLGPQVKFIYDTKGPDIVVLGST
INGSNITINGIAVDEKGVASGTVNGQAISFDNDGAFQVTIPKANVYTYQTKDTIDHTNTV
HYADLNQQYNPAVSVEITQRGLDFATKQIVNALNGADLNPMIAGTMLYDSTWKGLFGETY
GADGFVRQVELSAERFDLDLQNGSAASFDGRLTNVHIALTLRLHNGLLPPTIINVGATVG
PLDIGGDLALGVQDDAPTVSISNLSYQIGNIAIDNFNVPGLNEIISGVVSGIANLMEGPI
SNLLEGIISDEVPKLIKQLVQDSYTLRIQDHVGRNFDMAAAIRIKSLSTTTNTLTVSTSG
SVLPINPDTANIAQPYAGTLFTFDTMPAASVGSEDFAASINSNMINQVLASAHAVGLTQM
NIVGDEFQLGLPRDDMFGQGNMRILVNMAAPARIQISEVDGKASPLLSVYGLEIHGQSKK
NGSSTYTNDVAVRVNAEVGLTLGLGDANSLGVALRNSPQFKITGVKLGNGAWSGPVVNAA
ANSLITSSLGGVMLTIAKPIEKIKLPAFACMAFSSINITAVGAEKGHLNLAGTLSKVSDE
CDNPVALPPKMAYGRGVGVPMSCGSQKEYDAGLCYNACDAGYNGVGPVCWKQEASYGRGV
GTIPHLCAAGEEMDAGLCYPKCNAGFHGVGPVCWNDMPGSYGRGVGTIPSNIFTGACPAG
KENNAGLCYKYCNAGYHGVGPVCWLDTPSYGRGVGTIPKTCAAGEQLDAGLCYPKCSAGY
HGVGPVCWTDSALSYGRGVGTIPNTCENGWDKDGLLCYPQCEAGYNGVGPVCWPQN
Download sequence
Identical sequences E1VHU0
WP_013260883.1.92237 gi|304310443|ref|YP_003810041.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]