SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|304313369|ref|YP_003812967.1| from gamma proteobacterium HdN1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|304313369|ref|YP_003812967.1|
Domain Number 1 Region: 200-384
Classification Level Classification E-value
Superfamily Bactericidal permeability-increasing protein, BPI 0.0000196
Family Bactericidal permeability-increasing protein, BPI 0.021
Further Details:      
 
Weak hits

Sequence:  gi|304313369|ref|YP_003812967.1|
Domain Number - Region: 431-532
Classification Level Classification E-value
Superfamily Bactericidal permeability-increasing protein, BPI 0.0445
Family Bactericidal permeability-increasing protein, BPI 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|304313369|ref|YP_003812967.1|
Sequence length 768
Comment hypothetical protein HDN1F_37620 [gamma proteobacterium HdN1]
Sequence
MLFCPAGGFSMRIDVRNLFLVTLFAVFLTACKAVTVTNPVGGEVYTTPPDIALSFTKGQP
ATLKITLNDQDITSLFVIQAEGALAAGASIADYLVDGENFLRVVTPATPTVKFLYDAAGP
VVHITQVTEGSTLVVRGYAEDPSGVQSVQVNGSAVSLNASNQFEAQVANANFITFTATDR
IGRVRVQKFARPTVSVANSLSVRVSSAGLNFIKGELESLLKTSALGGLLKGMNPLKEECI
LGSCYRINVNDATIADNKLNLAVKNSADGRLDVSGTLSGFWADAEVRLDPLIGWTTRIPV
AASVDKITFSTTAKVSVGAGNQLKVSLENLSLSLGKLSADVSILPSWLVDPFLNAFKGIV
VWILEGQLKAILPAKMAEMVDTFPRNIVIDINGNQISPEILPASIATPENGLVIGLGARI
NAITHKGPAIVGYPWKEIAAVPAASNVSPKGAVRDIGIVISQNMINQALAAVTTSGMLTV
SMTDKDIPGLKDINGAGSAESVRVRLNAASAPSLELVKSSRGLATFRMHDVYLGLDAAID
KKGTMRTVMGATVDIEATANLGMTDQNALSVEFAGSPRIKIRAMDPASTLVLGNNLAQSF
INELTPKVVPVVLGMIGAIPLPSFEGYNLSVGEIWVTDESANYIGLVASMIRAQGKAARA
APHLSAYVENGTTASVSGVRSARAANAVTVEGNVVTIALNGYNPDLAAGDLQYRYRVDGA
PFSVWRERESIELYGLNAGLHTIEICARTAQLVPSDECATVHVQIKGS
Download sequence
Identical sequences E1VFJ3
gi|304313369|ref|YP_003812967.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]