SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|300722358|ref|YP_003711644.1| from Xenorhabdus nematophila ATCC 19061

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300722358|ref|YP_003711644.1|
Domain Number 1 Region: 2965-3235
Classification Level Classification E-value
Superfamily PMT central region-like 4.71e-89
Family PMT central region-like 0.00013
Further Details:      
 
Domain Number 2 Region: 3237-3459
Classification Level Classification E-value
Superfamily EreA/ChaN-like 1.44e-70
Family PMT domain-like 0.0015
Further Details:      
 
Domain Number 3 Region: 2415-2657
Classification Level Classification E-value
Superfamily PMT central region-like 3.79e-39
Family PMT central region-like 0.01
Further Details:      
 
Domain Number 4 Region: 4691-4899
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000000000222
Family Serralysin-like metalloprotease, C-terminal domain 0.0031
Further Details:      
 
Domain Number 5 Region: 4605-4703
Classification Level Classification E-value
Superfamily beta-Roll 0.00000183
Family Serralysin-like metalloprotease, C-terminal domain 0.0027
Further Details:      
 
Domain Number 6 Region: 1491-1629
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000068
Family beta-mannanase CBM 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|300722358|ref|YP_003711644.1|
Sequence length 4970
Comment toxin RtxA [Xenorhabdus nematophila ATCC 19061]
Sequence
MFKMTTVSVGYSGSQFNFFCPIPGLFMGKSASRSTAYAFTGKYEDDNDGNTIHAIGIDGV
INAYGGNDYIVVVSARAVVNTTWGHDTIVGGAGYLDVNDTGGDLTVKGASGFTSINKTQS
GPITFEGVSGGVKINHTGDKSGIFYSGAAGYNSITRKGLQGDISFKGAGAYNELWHETNQ
GNFSFAGAGGANKIDRTWFNRYQGSHGDLTFKGAGAANIISSGVESGNVEFEGAGAANNI
VRKGKIGDVTLRGAGASNHVERIREADDVYSETKGNIRFEGVGGYNSLYSDVAHGDIHFA
GAGGYNQITRKGTANDVNSEGIQYAKAEAIVLTKATMGGSWIGDTSYQVTGLKSAQQPNT
YLFAFVDGTHTKINKVQLRNDPQTGKLIYHSTSWYKEGNHLSDIEKKDISEQGGFNATNT
DGAYTLSNLTVESRQDAVFNAVQEKLVENKWMAYGGDILVNAADVTLLDAKMGGYAIGHN
GETADVNVVKSNRKPNTYIYAKKVDSYTKIVVVELRNDPKTGILQYHAQAWLNNGDHVAN
LGNEDISPDNGYQALPGGIYVLSDLHYSAKAVRMSSGRVAKMREYSDQELFQSATDSGES
SGDVHYNGAGGGNVIKSNVTRGNVYFNGAGIANIIEHSSDFGNTEFNGAGGANVIIKKGK
EGNLSFNGAGIANVLLHQSQRGDMNINAGGAANVLVRVGDGRYLAHLLAVGNISIHKGNG
NSRISMGGGFNTHTQIGNGDAFWTGVGGANVLTQTGNGDVSSILIGGANVLTKMGGGHLE
SAMFGGANIITHISNNQGTSDTKAFNTKAIALGGANVLTKKGKGDVQAVMGGGVNVLTHV
GDGKTTGVMLGGANILTKVGNGDTTGIMFGLGNVLTHVGNGQTLGVMVSAGNIFTKVGND
TTIAAMIGAGNIFTHVGEGNAWALMGGAGNIFTKVGNGDALALMLAFGNVFTHVGDGMSV
ALMIAKGNIATKVGNGDVLSAMIGKGNIFTQIGHGSTFAAMIGGANVLTKVGDDLTAALM
IGEANIYTHVGKGTSIGLFGGSANIMTKVGDGTTLAAMFGKANIMTHVGDGLTGVLALGK
ANIVTKVGDDFMGVVAASEANIVTHVGDGTTAALLSGKGNILTKVGDGTTVGLLKSEIGN
IMTHLGDGTTVGFAKGDANIITKVGDGLGINAAWGKANVMTHVGDGDRYNFAKGEANIIT
KIGDGQEVTVVQGQANIVTHVGNGDDYTGAWGKANVITKVGDGRNVVLAKGEANIVTQIG
NGDSFNALWSQGNIVTKVGDGIQVTAAKGEGNITTTAGDGLNVTAVHGDLNINTKVGDGV
SVNVAWGKLNVNTRVGDGLNVSVMKGKGNANIRVGDGLNINASYARNNVAIQVGNGDFYS
FAVAESNTESNKLDALFANIKQTLLGSAGSQGINYLVNGDEASTSGTHKGRGAINLPEVS
SLDGFKLTEIGEITSDLQNGLKGTVSGADEPNTDGIENALGNERRLNPNQQRNLIVNGDF
EKGAEGWTYTNGIEASHSATAYGLSVEGHGERVSELDVSGNTHLYQDIKNLTADEKIVVK
FDFARRAGSAADNGLEVWWNGKVVFAEANGNTEWQNKTLTLTAKAGSNRLEFSGVGRNDG
LGYVLDNVVATSELSESHLAEHVKQDKAAQNALQDKAQAEADRQRLEQEKNNQLAAISGT
QKQLENTDLNALNANGQSQRDAIDGEARAFTDELKEKVKGLDALDSYATYDGKSGEQWHQ
FADGLKGRIQTQLDSTSETAKKQLADSQQAAAGRLNDIKDAVAKSEAGVIDGEKNQLNAE
QDIDKARAEAKFREQEATRQQQRAEQAKHDGNLAAQKAEQRGQQEVFAANNKTAQVQSNA
QGSKLDANYKPNRAGAAGSGLSGKVLTDSHNVSLESDAESGFDPNVELPAQTNAGFSAEL
QFIDEDLNELSNAKEALNRLQINAGVRARKASVGSSLTSAYTETPIHQPVSKVTRSSAEI
SRDTPRISGLDLSGLQALSETLAQPESSDIPETVSAAAIRAQKVADVYRWLDSDNDFATE
KYIPVPGFDRVDTDIPDDTRQKMVDFVERYISNTENSVPKEQAASLAKLFVDATIDYDWD
KRVEFISRLEHYGYSFEPVHGDKSIVSFWSGKNFKQYRDILDAAQLDGKKVVYDIDVKGN
AFAIQLNKTLTRWSGFYLDSDNADQKALQSAIDASAYSNTGFWSSLYATGSRDDVYVIAE
GGLRLGNYFWNVELPVLRQLQREGLVGEIRLLDKTAKEYADVPPESIGRRLTDAGVPVKA
RFDSLSFEEQKRLLALNPDGYKPDTLINLDIKTSAIDSLLNKALPFYGLRTERNLLVRKS
EDGKGFKVRPWPGNHRDEFKTIMVDDPKDSNQIKAIERFILANYDNYGKLPEALYLADDR
IVSYDQGRTRIVAKKVEGSWNYKPKAELISAAELQEAAYVKGKILGDSYRNVLDALRDYE
NTLQNSKDYDLNAVEKLTYLHHQVEGYLLGHPDSARIPALKNLLSQINVRMEESLILAEP
ALKSAGKGNFSELYNKLGNAKLKDSKHLYIDEQGDFVTRGKSNIQIAMKAESAENAVEQV
KAAVTREYGQSVTDAVFANLNTRDLAKDGKGIDVSGLKKVHHAIEQQLSPVSATLFVWKP
SDHSSLGHAALQIGQGRIQISAEKAGEFNEKNYVSWWPKGIKSPNIGDIFNVSSEHNPDV
RLRWRDLSQPARQHTLLKTDVAFEEGDKFGMQDGSYKLAKFNKELEVAKEGYARFADFSE
NTAIMMLENPKILQSAGIPESISRPFVERVEAGGADVFELGKEFAEALRTAAKQQHTPEL
AEEHTANIIRQFAEHELSDIQGFKTSEADQGRVFRISLAGLDAAAMQAEWQKISQNPDAR
YQLLNGNCSSIVAKVLKAGGADKIIGHTWRPKFGVWTPTELFNFAQKLQEVQIETAAKKQ
PYSPVEELAALSGKNKTLETVIAENDGTPSLNELITKDGLRKKASVFAKPIGPAYQAILD
KLDHIHNLTGNEQLSAGFELYQRITRYLNEHPDSKRNTALSGVQTQLGDIMFRGALQEVR
SPLLEIAQTRPEMASRIYQIARNEARGDTPGLTDLMVRWVKEDPYLAAKLGYQGEIPADL
AFNPKFHVDLGDQFDDFKQCLSKAQDKGLLINARIDEQNKRVHLGYSYNELLDMTGSEDV
KMAVYFLKEVAKQADPNFAGSHEAILLNRFANPAYLVQLEQGRLAQIEAIYHSSHQTDIA
AWDKQYSSDALTQLNRQLSDGTDLNSQLSLLLKDRQGLLIGESHGSDLNGLRFVNEQMDA
LKVHGVTVIGLEHLRSDLAQPLIDKFLAGGDMPAELTAMIETKHLPVDLFEQAKSKGIKI
IALDDNSTTRPAIEGSQHGLMYRAGAANNVAVKRLGLLAEGEKFVAIYGDAHLQSHEGID
HFVPGMTHRLGLPALKVDANNRFTAQADDISLRKHYDDVPQLEKNLYKPNRVVGGDLEVL
GHSDESEILKGTKSLLKRYLEVLKPEVNSAGITTKDIRTTKDFLVGYKQGYAEQIVDGFR
SKMDVKQLVDLLVKGDWSAEQKGALAWEIESRALKITFQPKAEKFNRLFRDVASAGIADT
KANEQAAPQLLLLNLSNDGFDGRCDPLSKLVLVAKQLENDGQDGVARQLLEKMYSAAAVL
SKPNRYSETEHANASKLLGSLAALHAKNPMANTFTKVWKEKLEDAKALTIDGVVQKITAG
NADGKPVLLELDAPGHAMAAWAKGSGENRVYGFYDPNVGIVEFSSAEKVGAYISRFFGES
DLNMAQRYQLPKNEAGEIVFKRVVVMDGEILATYRPIPADKTTMRGMLELPVFDDTPIRK
PTDIDATDGIKKPLGDNSPESHIRVNNHDVGSWENITVKPQPESGDSRFSGQIIIQTEND
PVAAKAAANLAGKHPDSSVIVQLDANGQYRVVYGDPADLSNKLQSGKLRWQIVGHGREES
AQNHTRISGYSADELALRLKQFSIDFKQAGKPDHISLVGCSLISDDKRNGFARRFISALN
EQGVRTTVSARSSEVAVDSIGRKYTKDAQDQWVHKLTDNKIVLGWNDKGEVESHSERVRR
GISENDIFLSRVGHTAVDAKAQGAIADNVETFHAPKKRNENGENNPATSLKSNKQLSYSG
NIQLQVGDGEFTAVNWGTTNVGIKMGTGGFKSLAFGDNNVMVHIGNGDSKHSVDIAGYQA
LEGAQLFVGNRNISFNWGRSNDLIVMLEKSIPTPPLVNPFDGAARISGVLQNIAGSYDSP
DWLTTQNQQWTLESAKKYVSDLSGLDLTSSVDYKTLTDLDSQNERSSRGLKSDIESTLNK
QFNQWLGKSGNTLDMGKISRADKFRQANEKLAFNFAVGGQGADIQVTTGNWNFMFGDNIQ
SILDTNLGSLFGLMKQEYTSTGMAKTTFTFSPKDLPRQIKNKLLGDLAGVSADTTLADIF
GVDYTADGKIVSRSNQPVDGVAILREMLEIIGEFSGSQLQAFTDREKLRDGLRAALDLGA
DGVKSFAESHGLKAAAPDEKQSEHVSINEENKPVPTTEELQADRALGLNSLNLPNLFATL
FSKNKQTEMKSQVTNLKENLTADLLNIQDKTFDFLRNSGHLKGNGDINVSLGNYNFNWGG
DGKDLGAYLGENNNFWGGRGDDVFYSVGTSNIFTGGAGNDTGVMMGRENMMFGGAGNDVA
VLAGRINYAYMGEGDDQVFAFGEGGMIDAGKGRDYIVASGNFNRIEAGEDQDYVVTIGNN
NQVDLGEGNDFARVFGNYNRIDGNTGNNSIKLMGYHAMINGGTGNDHLIADVVSKFSQFD
GGDGDDLLVLGGYQNSFKGGTGVNSYVVSGDVIDNVVEDIKQGDKIIFNDINWQNLWFQR
SGYDLVLSTHRNVKDSSAQGQFEAMGSVTFNNYFNGNRADIITQMGDKDAQGEREYTALS
ANGVDSLVQAMSGFAPNMGDSGFIDSLDSQTKSTIVTAWSDTTNGKSRLA
Download sequence
Identical sequences D3VAK8
gi|300722358|ref|YP_003711644.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]