SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296137633|ref|YP_003644874.1| from Thiomonas intermedia K12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296137633|ref|YP_003644874.1|
Domain Number 1 Region: 273-448,587-673,751-829
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.1e-26
Family ABC transporter ATPase domain-like 0.03
Further Details:      
 
Domain Number 2 Region: 41-156
Classification Level Classification E-value
Superfamily PHP domain-like 0.00000000294
Family PHP domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296137633|ref|YP_003644874.1|
Sequence length 884
Comment SMC domain protein [Thiomonas intermedia K12]
Sequence
MSDQYTYARFWRCALQVNPVGYNGTYRGADHGLDEGGYNQALLQKCLELGITVVGLADHG
SVASVDALRQVLQPRGIVVFPGFEIASNDKTHYVCLFSEETTGQQLERYLGNLDLLDPTD
GVRPSRLSSEQLIEKVDQLGGFIYAAHCTSDSGLLKNRLNHVWKLHKLRAAQIPGPIDDL
AGVESDFYRRVLLNKDDAYRRERPVAVINAKDVAKPEDLEQPGATCFIKMTRPNFAAFKV
AFLDPGSRIRLNSQQAQSPIGKVVRMTVAGGYLDGVRVDFSDHLNTVIGGRGTGKSTLLE
CLRFALDLPPKGKQAQKLHQEIIKENLGRSAGRVELTVVSSAQNGKQYTISRRHGEPPMV
RDMDGNVSTLLPRDLLPGIDIYGQNEIYELAQDETSRVQLLDRFLPQDGQYESKSADVHR
RLKDNQQKLTKSLTDLDELNAQVERLPKLEEQLRGFDELGIKEKLAKTSLLAREREIAKT
ATEGVQNFRDALTDLRDSLPDLDFINDEALEGLPDAAQLLAMRTTLDGLKQGFTGHLTAM
QALLDDKAGQFTTQHDAWQQAIQAHDVELEKALRTLPATAGKSGQEVGVAYQKLMGEIER
IKPMKSRATTHESQRDTLRQERRNLLAELSDLRAQRIQALQKAAKKLNRRLEGKLKVEIV
PEADRTPLMTFLLGCKLDGVGEKRLAFIEEAETISPLSLAQSIQKGSADVQLDWGVTQMV
ADALTKLQSSQLMELEALELEHRADIFLNVAHGQADPVFRPLNKLSTGQQCTAILHMLLL
ENVDPLLMDQPEDNLDNAFIADRIVAELREAKTSRQFLFATHNANIPVFGDAEWIGVFTA
AENQGRLGLEAQGSIDVPVIRDQVASILEGGRDAFIQRKEKYEF
Download sequence
Identical sequences D5X735
gi|296137633|ref|YP_003644874.1|NC_014154 WP_013124609.1.68284 gi|296137633|ref|YP_003644874.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]