SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297572021|ref|YP_003697795.1| from Arcanobacterium haemolyticum DSM 20595

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297572021|ref|YP_003697795.1|
Domain Number 1 Region: 63-471
Classification Level Classification E-value
Superfamily Multiheme cytochromes 4.93e-130
Family Di-heme elbow motif 0.000000464
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297572021|ref|YP_003697795.1|
Sequence length 495
Comment nitrite reductase [Arcanobacterium haemolyticum DSM 20595]
Sequence
MSSEHTDVETQTPSSNSAAKQPRSWLAIAVLVIVALVGAAITWLLLDIVSHKQEAAHPWS
PVTKIDDTTFDSETWGQNFPRQYEGFKATSKLNEERKIPNTEPNVPEDKREFKTRSKLEI
EPRLVSIWKGYAFSVEYNEPRGHEYMLEDQKFVKRMTDFKQPGACLNCHASIPQVVNSIN
PNDPADGWAQMNKMPYDEAVQHANGPIGCIDCHDPKTMKLRVSRPAFIEGIKAAKAAEGI
KDFDVNKDATHQEMRTYVCAQCHVEYYFKGEGKTLTFPWTKGLTVNDAIDYYDEAGFSDF
THKDTGAEVIKAQHPDFETWSQGIHADNGVSCADCHMPYKRDGAAKISDHQVRSPMADDE
QINATCLTCHHSSAKEMRGRVEAIQHRWSDAKDTAFTAVQSLIEDITKARAEGNVSEANM
KKAQEFQRKAQFIVDYSVSENSRGFHAPQYSVAILNEATDYARSGQLALRGIQVETKRPA
SSYTIAPVDRPGPRK
Download sequence
Identical sequences D7BKJ6
WP_013170666.1.46033 gi|297572021|ref|YP_003697795.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]