SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297571240|ref|YP_003697014.1| from Arcanobacterium haemolyticum DSM 20595

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297571240|ref|YP_003697014.1|
Domain Number 1 Region: 17-260
Classification Level Classification E-value
Superfamily Cgl1923-like 4.84e-48
Family Cgl1923-like 0.0000373
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297571240|ref|YP_003697014.1|
Sequence length 340
Comment hypothetical protein Arch_0661 [Arcanobacterium haemolyticum DSM 20595]
Sequence
MANFVTYPENLGDVTVPTLLIGLVDHLVDPGAIGQAVNACIDLLDSVEVATFDADPLYDY
RAQRPIVTYVDGILASSFEPGMSLVLVTDVNGNPFLYLHGTEPDFHWPRLTEDILEIVSR
FGVEHIFSINGMPAPIPHTRPADMLIRTTQHVENPAIVHGQASHPASLSDYAEYQLGTQG
YKATNIRVRVPLYMSRSDMPFFSGALAVVRQLATLGGPTIPLGDLEQHEDQQAVELVGVA
EQDEQFARMIAQFEEEYDSSDQGFVKIHEESGPLPTPDEIGAAVERFLAMQDSNPLEGIV
TQPERAPKEKTKAAEPAQAQDLRTQLKNSLSQLFNRKHGN
Download sequence
Identical sequences D7BN96
WP_013169893.1.46033 gi|297571240|ref|YP_003697014.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]