SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297618137|ref|YP_003703296.1| from Syntrophothermus lipocalidus DSM 12680

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297618137|ref|YP_003703296.1|
Domain Number 1 Region: 81-445,475-544
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 3.36e-126
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.0000849
Further Details:      
 
Domain Number 2 Region: 6-74
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 0.0000068
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297618137|ref|YP_003703296.1|
Sequence length 571
Comment ribonucleoside-diphosphate reductase, adenosylcobalamin-dependent [Syntrophothermus lipocalidus DSM 12680]
Sequence
MLSADGQKLFEARYAIRDEKGTVAETFDQAVGRLARTVATAEKEPSQWEERFARIIGELF
FVPSTPIWANVGKPDRPWQPAACFVLPLEDSLESVFETLKDTALVFKSGGGVGYNFSAIR
PRGFPVRSSQGQAFGVVELLRLYDHAAGIIVQGGVRRGACMGILNADHPEILEFIRAKLA
GGLANFNLSVGVGDAFMEAVRENGTWRLVFNGQAIAELPAAEVWEAIVEASHACGEPGLV
FLDALQRSNPIRGTVIAATNPCGEVPLLAGESCILGSINLAPMVDAAGNLKEVQLAETVG
IAVRFLDNLIDVGQYPLTFIAQTTRATRRIGVGFTGLADALIKSGLAYDSEEGRAWADRA
AAIIKAAAEEASRELAREKGAFPWWGRSVYYPDDPRRNAALLSVAPTGSVTLIAACEGYG
IEPIFAVAYTKSTSAAGKIEVFSPLFLQECERHGIPETVRSEVARRGSCQGVDGIPADMA
RVFKGAREIAPEDHLLMQAAVQKHVDNAVSKTVNLPREATPADVDHTFRLAWELGLKGVT
VFREGAKPAPVTVGAGEPEEPPEAHRNCCWV
Download sequence
Identical sequences D7CPV3
WP_013176133.1.24510 gi|297618137|ref|YP_003703296.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]