SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Amamu1|809777|CE608540_2663 from Amanita muscaria Koide v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Amamu1|809777|CE608540_2663
Domain Number 1 Region: 9-106
Classification Level Classification E-value
Superfamily Fungal immunomodulatory protein, FIP 1.96e-33
Family Fungal immunomodulatory protein, FIP 0.0000569
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Amamu1|809777|CE608540_2663
Sequence length 114
Sequence
MSLTGVNEGLVFLLVSQVKKIDFDYTPHYYRPTSGYTDAVTFPKVLANKAYKYQVVVDGV
SKGIRRDHAVAPDGSQKINFLDYNAGYGIPNKSSTQVYAVDPDTGIAYYILTVS
Download sequence
Identical sequences A0A0C2WK68
jgi|Amamu1|809777|CE608540_2663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]