SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Amamu1|186568|fgenesh1_pm.24_#_5 from Amanita muscaria Koide v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Amamu1|186568|fgenesh1_pm.24_#_5
Domain Number 1 Region: 410-498
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000031
Family UBX domain 0.032
Further Details:      
 
Domain Number 2 Region: 214-304
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000895
Family Thioltransferase 0.047
Further Details:      
 
Weak hits

Sequence:  jgi|Amamu1|186568|fgenesh1_pm.24_#_5
Domain Number - Region: 5-46
Classification Level Classification E-value
Superfamily UBA-like 0.00209
Family TAP-C domain-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Amamu1|186568|fgenesh1_pm.24_#_5
Sequence length 607
Sequence
MDALNDNQRHALSQLHELTNGGDDETAINILESVGWDVQQAANLIFGGAAAPAPNTRLET
FDIDDSNQGLLEPNPGRHRARHAQPVASTLFLFARPIISFLAVPLHILANIVRFIFGLLR
IPVPQFHLRFVGLNFYRSFPTSRPNNRTHGLTDTGPERWIRELEEETGAVCVGRTRSARL
PGAASSAIDAGPSNLTERNVGPSSSVDYLLEDGRKVLPDFMTGSYEEMLRVCKKEARIGC
VILVSEEHDDVPAFKRSTLTDPTFVKLLYDNDIAVWGGDVKDREAWSASEKLQATTYPFV
AFLALQPRRSPSGSASSHSSSPSLTILSRHQGSSLPASGPTSAATLVSQLERQVLPRVVP
FLDVMKAAERERQLERQLREEQDLAYKAAAQRDKERIQARMRKEREEAEEKRRQEEKAKK
EQERRLMEDKERQRKEEEKLVWWRWIRRKFSEESSTGADDGPLRVAIRLPNGSRAVKRFR
SGASLTTLYAFVASQLIPAHLPEGRDPGTLPYGSIEGSMESCVESKLTTPDCGAQEWWGF
CVVNAYPRREIEWRANVRLGDVDCLRGGGQMVVEMLNLDKGRPAPRERTSVTVNDDDDGD
DGYDTEE
Download sequence
Identical sequences A0A0C2X6M7
jgi|Amamu1|186568|fgenesh1_pm.24_#_5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]