SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|300709429|ref|YP_003735243.1| from Halalkalicoccus jeotgali B3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300709429|ref|YP_003735243.1|
Domain Number 1 Region: 4-87
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.52e-31
Family Imidazole glycerol phosphate dehydratase 0.00019
Further Details:      
 
Domain Number 2 Region: 89-180
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.33e-29
Family Imidazole glycerol phosphate dehydratase 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|300709429|ref|YP_003735243.1|
Sequence length 195
Comment imidazoleglycerol-phosphate dehydratase [Halalkalicoccus jeotgali B3]
Sequence
MTDRTAEISRETAETEIECVLEIDGSGDSEVETGIAFFDHMLTAFATHGLFDLTVQCEGD
LAVDDHHTVEDVAIVLGEAFSAAVGDKSGMVRYADRRVPLDEAVASVVVDVSGRPRFYFD
GEFSQDTVGEMTSDMARHFAESLAMNAGLTLHLDVEGENAHHEIEASFKCLARALDDATR
LDERRGGTPSTKGKL
Download sequence
Identical sequences D8J3W0
gi|300709429|ref|YP_003735243.1| WP_008419126.1.63939 WP_008419126.1.7794 WP_008419126.1.86325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]