SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|300709884|ref|YP_003735698.1| from Halalkalicoccus jeotgali B3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300709884|ref|YP_003735698.1|
Domain Number 1 Region: 91-165,194-289
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0000000000107
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|300709884|ref|YP_003735698.1|
Sequence length 426
Comment glycosyl hydrolase BNR repeat-containing protein [Halalkalicoccus jeotgali B3]
Sequence
MDRRQFIALSAATTGSSIALAGCLGSSGDESESSEDTTTGDRESNDTDSEADQPEPEGGD
GEPYYHYDLEVHDKREAGQPVWVDQNGRVYGRDGPRVLVSDDWWQTTEVLYSFDGKRDGN
VQTIIVPDNGRVIAAVGGRSEEGGKVELINKDRTDSETLYQFDYGRVSNSMGHVAYEDII
VISCYKLSDYEAGDHGNEVILSTDGGKSFEKVLEPSVNSTEAANNHIHDVEYDPYAERIW
VAVGDHGNSQLYWSGDLGKSWSEIDDRGDITMVTQVAAFKDCVVLGSDGTPEGILRWERD
GPNDVPEEADDFERVHVEIETDPDDDVMQMYARRRWHIREDLETGRELCLMPFGYSPMND
SAEDSVVLASVDGDEWYELYRTETREILLTNVMGPLSMDGDRRTIVSDSNQGDGYQIDAT
VPKFWE
Download sequence
Identical sequences D8J6M9
WP_008418287.1.63939 WP_008418287.1.7794 WP_008418287.1.86325 gi|300709884|ref|YP_003735698.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]