SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|300710395|ref|YP_003736209.1| from Halalkalicoccus jeotgali B3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300710395|ref|YP_003736209.1|
Domain Number 1 Region: 126-201
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.84e-20
Family Translational machinery components 0.0019
Further Details:      
 
Domain Number 2 Region: 42-113
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 4.08e-19
Family Ribosomal S5 protein, N-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|300710395|ref|YP_003736209.1|
Sequence length 212
Comment 30S ribosomal protein S5P [Halalkalicoccus jeotgali B3]
Sequence
MARNNGWEPVTRLGRLVRDGDIETMDEALNSGLPLKEVEVVDQLLPGLEDDVLDINMVQR
MTDSGRRVKFRCVVAVGNRDGYVGYAEGRDDQVGGAIQKAIGIAKLNIIDVSRGCGSWEC
GCGRPHTVSLRTTGKAGSVEVELLPAPRGLGLAGGDTVRSVLELAGIEDAWTRSSGQTRT
TVNFAKATFNALRNTAEARVPEHAAAQREVIE
Download sequence
Identical sequences D8J9K5
gi|300710395|ref|YP_003736209.1| WP_008414544.1.63939 WP_008414544.1.7794 WP_008414544.1.86325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]