SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|300711103|ref|YP_003736917.1| from Halalkalicoccus jeotgali B3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300711103|ref|YP_003736917.1|
Domain Number 1 Region: 1-181
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.25e-40
Family GHMP Kinase, N-terminal domain 0.00041
Further Details:      
 
Domain Number 2 Region: 187-306
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 2.88e-31
Family Mevalonate kinase 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|300711103|ref|YP_003736917.1|
Sequence length 327
Comment mevalonate kinase [Halalkalicoccus jeotgali B3]
Sequence
MTTASAPGKVYLFGEHAVVYGEPAVPCAISRRARVTVERRGDSRLHVHAEDLSLDGFTVE
YSGEADATPDVDVSTDLVEAAMGYVDAAVSQAREAAGVPEAGFDVTVESAIPLGAGLGSS
AAVVVAGIDAATRELGVELSTTEIADRAYRAEYDVQEGQASRADTFCSATGGAVRVEGED
CRAIDAPDLPFVIGFDGGAGNTGELVAGVRELREHYSFAANTVETVGDIVRQGERALAAG
DLAELGTLMDFNHGLLSALGVSSRSLDRMVWAARDAGAHGAKLTGAGGGGCIVALDETEE
TETALRFTPGCEEGFRAELDAEGVRVE
Download sequence
Identical sequences D8J318
WP_008417433.1.63939 WP_008417433.1.7794 WP_008417433.1.86325 gi|300711103|ref|YP_003736917.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]