SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|300711592|ref|YP_003737406.1| from Halalkalicoccus jeotgali B3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300711592|ref|YP_003737406.1|
Domain Number 1 Region: 172-312
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.44e-30
Family Galactokinase 0.069
Further Details:      
 
Domain Number 2 Region: 1-162
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.26e-28
Family GHMP Kinase, N-terminal domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|300711592|ref|YP_003737406.1|
Sequence length 321
Comment diphosphomevalonate decarboxylase [Halalkalicoccus jeotgali B3]
Sequence
MRKITAVAHPIQGLAKYHGMRDPELRLPYHDSISVCTAPSHTKTTARFEDRTEDVYVVDG
EELSGRGKERVAAVVDRVRELAGIDDRVRLESENSFRSNVGFGSSSSGFAAAAMALCNAA
ELDLSRPDISTVARRGSSSAARAVTGAFSHLRTGLNDADCRSERIETELEDELRIVAGLV
PSYKETEQAHEEAADSHMFGARMAHMHGQIAELRDALREGDFDRTFELAEHDSLSLAATT
MTGPAGWVYWQPETIEIFNRVRELRDEGVPVYYSTDTGASVYVNTTEEHVQRVEAEVAEA
GVETHVWEVGGPARTVDDHLF
Download sequence
Identical sequences D8J4Z7
WP_008416829.1.63939 WP_008416829.1.7794 WP_008416829.1.86325 gi|300711592|ref|YP_003737406.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]