SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|300711958|ref|YP_003737772.1| from Halalkalicoccus jeotgali B3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300711958|ref|YP_003737772.1|
Domain Number 1 Region: 6-145
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.59e-16
Family GHMP Kinase, N-terminal domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|300711958|ref|YP_003737772.1|
Sequence length 297
Comment GHMP kinase [Halalkalicoccus jeotgali B3]
Sequence
MDDDAVTAFVPGHVTGFFSSHPDDDPSKAGSRGAGVTLTDGVTVRATPAARARTTLDGTE
IVVEPVDRVLDALSISVHVEATTDLPLGAGFGTSGALALGTAFAANQLFDRRLSANELVT
IAHAAEVRSGTGLGDVVAQARGGVPIRLDPGGPAHNRLDAIPASTRIEYLTFGDLSTESV
LSGDTDRLTDAGLESLSILAEEPTLSTFMYASRRFAREADLLTDRVRGAIEDVSAAGGEA
SMAMLGETVFALGTGLSEAGYDPSVCRTHAAGATVLEGAAPPPSASGPPRANNAGDL
Download sequence
Identical sequences D8J727
WP_008415912.1.63939 WP_008415912.1.7794 WP_008415912.1.86325 gi|300711958|ref|YP_003737772.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]