SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|300712788|ref|YP_003738600.1| from Halalkalicoccus jeotgali B3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300712788|ref|YP_003738600.1|
Domain Number 1 Region: 61-131
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000497
Family Myosin rod fragments 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|300712788|ref|YP_003738600.1|
Sequence length 223
Comment hypothetical protein HacjB3_17333 [Halalkalicoccus jeotgali B3]
Sequence
MNETSDEEMNIPDTEERMVQVAVEVPESVRDGAKAKLPYGGMSQVIREELNRVAFGEEMG
QRSRLESRLEDVREERDKLQRERRELNAKLENLEDQAKDIERKLDDLTTQEDRYEAKLES
LEYNIRIEGRNLFADHGQVESIAAEAGKSPEGVIKDLKHRNPDVPDEAFLSGLDGGGGFS
PPDKNPKSSLKSAKNIGYGKDGEMRPLEEREEKYRPRDPDADN
Download sequence
Identical sequences D8JCR4
gi|299883442|ref|YP_003738994.1|NC_014301 gi|300712788|ref|YP_003738600.1|NC_014299 gi|299883442|ref|YP_003738994.1| gi|300712788|ref|YP_003738600.1| WP_013199618.1.7794 WP_013199618.1.86325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]