SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296102067|ref|YP_003612213.1| from Enterobacter cloacae subsp. cloacae ATCC 13047

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296102067|ref|YP_003612213.1|
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily Phage tail protein-like 3.4e-45
Family Lambda phage gpU-like 0.0000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296102067|ref|YP_003612213.1|
Sequence length 132
Comment minor tail protein U [Enterobacter cloacae subsp. cloacae ATCC 13047]
Sequence
MKHPQIRAAVLTALKRSITEQITWFDGRPGFLEEEDLPAVAVYLTDARASEDSVDEDMWT
ALLHIEVFLKAKETDSALDAWMEEKVYPALADIPELLPLIELMNANGYDYQRDEEVMMWG
SADLSYSISYVM
Download sequence
Identical sequences A0A0H3CH90 A0A0M7I2K5
WP_013096337.1.12136 WP_013096337.1.2945 WP_013096337.1.38242 WP_013096337.1.40358 WP_013096337.1.55189 WP_013096337.1.88665 WP_013096337.1.92861 WP_013096337.1.97677 YP_003612213.1.53031 gi|296102067|ref|YP_003612213.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]