SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|300702482|ref|YP_003744082.1| from Ralstonia solanacearum CFBP2957

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|300702482|ref|YP_003744082.1|
Domain Number 1 Region: 424-443,482-729
Classification Level Classification E-value
Superfamily HAD-like 2.64e-56
Family Meta-cation ATPase, catalytic domain P 0.00032
Further Details:      
 
Domain Number 2 Region: 228-325
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 7.59e-27
Family Calcium ATPase, transduction domain A 0.003
Further Details:      
 
Domain Number 3 Region: 10-78
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 4.19e-18
Family HMA, heavy metal-associated domain 0.001
Further Details:      
 
Domain Number 4 Region: 192-228,326-417
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000000000222
Family Calcium ATPase, transmembrane domain M 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|300702482|ref|YP_003744082.1|
Sequence length 749
Comment copper transporting P-type ATPase [Ralstonia solanacearum CFBP2957]
Sequence
MTTASLADAASLDLEIQGMTCAACAGRVERALRAVPGVVAASVNLATERARIQRTDDVSG
DALVAAVVAAGYEARIASDEVTAAPAAVEPGFWDGPGPVWVSAALSLPLVAPMVAGWLGA
GWMLPAWLQWLLATPVQGVIGARFYRAGWKALRAGAGNMDLLVALGTSAAYGLSLWLWWR
ADAGDMPHLYFESAAVVITLVRLGKWLEARAKRQTAQAIRALQALRPDTARVRGADGTLR
DVPVARVRVGDAVSVRAGERIPVDGTVVEGASHVDQSMLTGESLPVPKRAGDHVTAGAIA
ADGVLLVRTTAIGADTMLSRIIRLVEDAQAAKPPIQQLVDRVSAVFVPVVLAAALVTLTG
WMIAGAGWEHAIVNAVAVLVIACPCALGLATPSAIMAGTGAGARRGILIADAQALERARQ
VDFVVFDKTGTLTVGQPRVAAVEAAPGLDGDAVLDQLAALQAEHTHPLAQATRDHAAARG
RTIAPARSPEVLAGRGVRGVVGGAVLLLGNARWMDELRLDRTRLQARADALEAQGHTVSW
LAQGEADGGVRLCGLIAFGDALKPGAREAVAELHRRGIRTALVTGDNAGAARGVAEALGI
DAVAAQVLPQDKAARVAAWQQSGHVVAMVGDGINDAPALAAADVGIAMATGTDVAMQAAG
ITLMRGEPRLVPAALDLSQRTVAKIRQNLFWAFVYNVVGIPLAACGLLSPTFAGAAMAFS
SVSVVTNALMLRRWRPRWESATATGDRAS
Download sequence
Identical sequences D8NKP9
gi|300702482|ref|YP_003744082.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]